Primary Antibodies

Jump to Filters
View as table Download
SCN11A Rabbit Polyclonal Antibody
TA322393

USD 380.00

4 Weeks

Anti-SCN1A/2A/3A/4A/5A/8A/9A/10A/11A/12A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1503-1520 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit
SCN1B (N-term) Rabbit Polyclonal Antibody
AP53815PU-N

USD 580.00

2 Weeks

SCN1B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 70-98 amino acids from the N-terminal region of Human SCN1B
Nav1.5 (SCN5A) Rabbit Polyclonal Antibody
TA321977

USD 380.00

In Stock

Anti-SCN5A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1860-1874 amino acids of human sodium channel, voltage-gated, type V, alpha subunit
Nav1.5 (SCN5A) Rabbit Polyclonal Antibody
TA328703

USD 850.00

2 Weeks

Rabbit Polyclonal Anti-Human NaV1.5

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen GST fusion protein with amino acid residues 1978-2016 of human Nav1.5. Intracellular, C-terminus.
Nav1.5 (SCN5A) Rabbit Polyclonal Antibody
TA338380

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-SCN5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN5A antibody: synthetic peptide directed towards the N terminal of human SCN5A. Synthetic peptide located within the following region: SEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALH
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA350718

USD 380.00

In Stock

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GRIN2A
NMDAR2A (GRIN2A) (Center) Rabbit Polyclonal Antibody
AP51952PU-N

USD 580.00

2 Weeks

NMDAR2A (GRIN2A) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1057-1084 amino acids from the Central region of Human NMDA Receptor 2A
Nav1.5 (SCN5A) Rabbit Polyclonal Antibody
TA314511

USD 380.00

4 Weeks

Rabbit polyclonal Sodium Channel-pan antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human sodium channel.
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA338510

USD 539.00

5 Days

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST
Nav1.7 (SCN9A) Rabbit Polyclonal Antibody
TA351634

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-SCN9A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SCN9A
Nav1.7 (SCN9A) Rabbit Polyclonal Antibody
TA314513

USD 380.00

In Stock

Rabbit polyclonal anti-SCN9A antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SCN9A.
Nav1.6 (SCN8A) Rabbit Polyclonal Antibody
TA338572

USD 539.00

5 Days

Rabbit Polyclonal Anti-SCN8A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN8A antibody: synthetic peptide directed towards the middle region of human SCN8A. Synthetic peptide located within the following region: ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA890121S

USD 188.00

2 Days

Rabbit Polyclonal anti-GRIN2A Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIN2A
SCN2B Rabbit Polyclonal Antibody
TA314509

USD 380.00

In Stock

Rabbit polyclonal anti-SCN2B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SCN2B.
SCN4B Rabbit Polyclonal Antibody
TA326109

USD 380.00

In Stock

Rabbit polyclonal SCN4B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SCN4B.