Primary Antibodies

View as table Download

Rabbit Polyclonal FIP1/RCP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the N Terminus Region

Rabbit Polyclonal Anti-RAB11FIP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB11FIP1 antibody is: synthetic peptide directed towards the N-terminal region of Human RAB11FIP1. Synthetic peptide located within the following region: ALLGLDKFLGRAEVDLRDLHRDQGRRKTQWYKLKSKPGKKDKERGEIEVD