Rabbit Polyclonal Anti-Hdac4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hdac4 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac4. Synthetic peptide located within the following region: SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL |
Rabbit Polyclonal HDAC4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC4 |
Rabbit Polyclonal HDAC4 (Ser632) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC4 around the phosphorylation site of Serine 632 |
| Modifications | Phospho-specific |
Rabbit anti-HDAC4 (Phospho-Ser632) polyclonal antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanHDAC4 around the phosphorylation site of serine 632 (A-Q-SP-S-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal HDAC4 (Ser632) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HDAC4 around the phosphorylation site of serine 632 (A-Q-SP-S-P). |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China
