Primary Antibodies

View as table Download

Rabbit polyclonal anti-ACSL6 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACSL6.

Rabbit Polyclonal Anti-ACSL6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACSL6 antibody is: synthetic peptide directed towards the middle region of Human ACSL6. Synthetic peptide located within the following region: GPGAIRYIINTADISTVIVDKPQKAVLLLEHVERKETPGLKLIILMDPFE

Rabbit Polyclonal Anti-ACSL6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACSL6 antibody is: synthetic peptide directed towards the C-terminal region of Human ACSL6. Synthetic peptide located within the following region: SGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYS