Primary Antibodies

Jump to Filters
View as table Download
Carbonic Anhydrase III (CA3) Rabbit Polyclonal Antibody
TA313538

USD 380.00

In Stock

Rabbit polyclonal anti-CA3 antibody

Applications WB
Reactivities Mouse, Rat, Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CA3.
CA5B Rabbit Polyclonal Antibody
TA315166

USD 380.00

In Stock

Rabbit polyclonal anti-CA5B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CA5B.
Carbonic Anhydrase XIV (CA14) Rabbit Polyclonal Antibody
TA315264

USD 380.00

In Stock

Rabbit polyclonal anti-CA14 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CA14.
Carbonic Anhydrase II (CA2) Rabbit Polyclonal Antibody
TA323748

USD 380.00

In Stock

Anti-CA2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Carbonic Anhydrase I (CA1) Rabbit Polyclonal Antibody
TA323825

USD 380.00

In Stock

Anti-CA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Carbonic Anhydrase I (CA1) Rabbit Polyclonal Antibody
TA323826

USD 380.00

In Stock

Anti-CA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Carbonic Anhydrase III (CA3) Rabbit Polyclonal Antibody
TA327000

USD 365.00

3 Weeks

CA3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CA3
Carbonic Anhydrase II (CA2) Rabbit Polyclonal Antibody
TA342840

USD 539.00

5 Days

Rabbit Polyclonal Anti-CA2 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CA2 antibody: synthetic peptide directed towards the N terminal of human CA2. Synthetic peptide located within the following region: SQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVH
Asparagine synthetase (ASNS) Rabbit Polyclonal Antibody
TA342876

USD 539.00

5 Days

Rabbit Polyclonal Anti-ASNS Antibody

Applications WB
Reactivities Rat, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ASNS antibody: synthetic peptide directed towards the C terminal of human ASNS. Synthetic peptide located within the following region: SVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADR