Primary Antibodies

Jump to Filters
View as table Download
BDNF Rabbit Polyclonal Antibody
TA328615

USD 905.00

2 Weeks

Rabbit Polyclonal Anti-BDNF

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor).
NGF Rabbit Polyclonal Antibody
TA349414

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-NGF Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NGF
BDNF Rabbit Polyclonal Antibody
TA319152

USD 765.00

In Stock

Rabbit polyclonal anti-BDNF antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli.
Neurotrophin 4 (NTF4) Rabbit Polyclonal Antibody
TA322527

USD 380.00

In Stock

Anti-NTF4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 25-210 amino acids of human neurotrophin 4
BDNF Rabbit Polyclonal Antibody
TA328614

USD 850.00

2 Weeks

Rabbit Polyclonal Anti-proBDNF

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DEDQKVRPNEENNKDAD, corresponding to amino acid residues 72-88 of human BDNF (precursor). Pro-domain of the BDNF protein.
BDNF Rabbit Polyclonal Antibody
TA346304

USD 539.00

5 Days

Rabbit Polyclonal Anti-BDNF Antibody

Applications IHC, WB
Reactivities Mouse, Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
BDNF Rabbit Polyclonal Antibody
TA323909

USD 380.00

In Stock

Anti-BDNF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 153-168 amino acids of Human brain-derived neurotrophic factor
Fas Ligand (FASLG) Rabbit Polyclonal Antibody
TA313465

USD 380.00

In Stock

Rabbit polyclonal FAS ligand antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FAS ligand.
NGF Rabbit Polyclonal Antibody
TA321493

USD 380.00

4 Weeks

Anti-NGF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 80-94 amino acids of human nerve growth factor (beta polypeptide)
BDNF Rabbit Polyclonal Antibody
TA323908

USD 380.00

In Stock

Anti-BDNF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-247 amino acids of human brain-derived neurotrophic factor
BDNF Rabbit Polyclonal Antibody
TA327032

USD 365.00

3 Weeks

Rabbit anti-BDNF Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BDNF
Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody
TA328681

USD 850.00

3 Weeks

Rabbit Polyclonal Anti-proNT-3

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DTELLRQQRRYNSPR, corresponding to amino acid residues 89-103 of human NT-3 (precursor).Pro domain of the NT-3 protein.
Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody
AP23334PU-N

USD 560.00

2 Weeks

Neurotrophin 3 (NTF3) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide mapping at the middle region of Human Neurotrophin-3
Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody
TA328680

USD 850.00

3 Weeks

Rabbit Polyclonal Anti-NT3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide GEIKTGNSPV(C), corresponding to amino acid residues 39-48 of mature human NT-3 (residues 177-186 of the NT-3 precursor).
NGF Rabbit Polyclonal Antibody
AP20675PU-N

USD 465.00

3 Weeks

NGF rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated