Primary Antibodies

Jump to Filters
View as table Download
SULT1A1 Rabbit Polyclonal Antibody
TA331008

USD 539.00

5 Days

Rabbit polyclonal Anti-SULT1A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SULT1A1 antibody: synthetic peptide directed towards the N terminal of human SULT1A1. Synthetic peptide located within the following region: ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT
SULT1A1 (Center) Rabbit Polyclonal Antibody
AP12295PU-N

USD 580.00

2 Weeks

SULT1A1 (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the central region of human SULT1A1.