Rabbit Polyclonal anti-PDPK1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDPK1 antibody: synthetic peptide directed towards the middle region of human PDPK1. Synthetic peptide located within the following region: IIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVS |
PDPK1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PDPK1 |
PDPK1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse PDPK1 |
PDPK1 pSer396 rabbit polyclonal antibody, Aff - Purified
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S396 of human PDPK1. |
Rabbit polyclonal PDK1 (Tyr9) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PDK1 around the phosphorylation site of tyrosine 9 (Q-L-YP-D-A). |
| Modifications | Phospho-specific |
Phospho-PDK1/PDPK1-S241 Rabbit mAb
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S241 of human Phospho-PDK1/PDPK1-S241 (NP_002604.1). |
Germany
Japan
United Kingdom
China