Primary Antibodies

View as table Download

Rabbit anti-ADH5 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ADH5

Anti-PRDX6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6

Anti-PRDX6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6

Rabbit anti-PRDX6 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRDX6

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the N terminal of human SHMT2. Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the C terminal of human SHMT2. Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE

Rabbit Polyclonal Anti-PRDX6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the C terminal of human PRDX6. Synthetic peptide located within the following region: VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP

Rabbit polyclonal antibody to MTHFR (5,10-methylenetetrahydrofolate reductase (NADPH))

Applications WB
Reactivities Human (Predicted: Mouse, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 21 and 248 of MTHFR (Uniprot ID#P42898)

Rabbit anti-SHMT2 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human SHMT2

Rabbit polyclonal Anti-SHMT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT1 antibody: synthetic peptide directed towards the N terminal of human SHMT1. Synthetic peptide located within the following region: NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG

Rabbit Polyclonal Anti-ADH5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADH5 antibody: synthetic peptide directed towards the middle region of human ADH5

Rabbit Polyclonal Anti-PRDX6 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the middle region of human PRDX6. Synthetic peptide located within the following region: ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD