Rabbit Polyclonal anti-GRIN2A Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRIN2A |
Rabbit Polyclonal anti-GRIN2A Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRIN2A |
Rabbit Polyclonal Anti-GRIN2A Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GRIN2A |
Rabbit Polyclonal Anti-GRIN2A Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST |
Rabbit Polyclonal anti-GRIN2A Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRIN2A |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Anti-NMDA NR2A Subunit Antibody
Applications | WB |
Reactivities | Rat, Mouse, Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein from the C-terminal region of the NR2A subunit |
Rabbit Anti-NMDA NR2A Subunit Antibody
Applications | WB |
Reactivities | Rat, Mouse, Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein from the C-terminal region of the NR2A subunit |