Primary Antibodies

View as table Download

Rabbit Polyclonal Antibody against GLUT1

Applications ChIP, FC, ICC/IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166]

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific

Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185
Modifications Phospho-specific

Rabbit polyclonal anti-GLUT1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GLUT1.

Rabbit polyclonal AKT1/2/3 (Ab-315/316/312) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A).

Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C).
Modifications Phospho-specific

Rabbit Polyclonal JNK1/2/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3

Rabbit Polyclonal GLUT1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human GLUT1.