Primary Antibodies

Jump to Filters
View as table Download
PSMB10 (C-term) Rabbit Polyclonal Antibody
AP53486PU-N

USD 580.00

2 Weeks

PSMB10 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 213-242 amino acids from the C-terminal region of Human PSMB10
PSMB10 Rabbit Polyclonal Antibody
TA342171

USD 539.00

5 Days

Rabbit polyclonal Anti-PSMB10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMB10 antibody: synthetic peptide directed towards the middle region of human PSMB10. Synthetic peptide located within the following region: DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG