Primary Antibodies

View as table Download

Anti-GRIA3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 290-302 amino acids of Human glutamate receptor, ionotropic, AMPA 3

Anti-GRIA2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 263-276 amino acids of Human glutamate receptor, ionotropic, AMPA 2

Anti-GRIA2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 263-276 amino acids of Human glutamate receptor, ionotropic, AMPA 2

Rabbit Polyclonal GluR1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GluR1

Rabbit polyclonal Glutamate receptor 2 (Ab-880) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-S-V-K).

Rabbit polyclonal anti-GRID2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GRID2.

Anti-GRIA3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 290-302 amino acids of Human glutamate receptor, ionotropic, AMPA 3

Rabbit Polyclonal GluR1 (Ser863) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GluR1 around the phosphorylation site of Serine 863
Modifications Phospho-specific

Rabbit anti-GRIA1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIA1

Ionotropic Glutamate receptor 2 (GRIA2) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Ionotropic Glutamate receptor 2 (GRIA2) (+ GLUR3) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Chicken, Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Peptide corresponding to amino acid residues from the C-terminal region of rat GluR2/3.

Rabbit polyclonal Glutamate receptor 2 (Ser880) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-SP-V-K).
Modifications Phospho-specific

Rabbit Polyclonal Anti-Gria3 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gria3 antibody is: synthetic peptide directed towards the middle region of Rat Gria3. Synthetic peptide located within the following region: TVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYM

Rabbit Polyclonal Anti-Gria3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Gria3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EEMDRRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYMLANLGFTDIV

Rabbit anti GluR 2/3 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated