Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Primary Antibodies
View as table Download
Rabbit monoclonal anti-Sox2 Antibody, clone OR-4F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit Polyclonal Anti-SOX9 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ |
Rabbit polyclonal KLF4 Antibody
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 481-504 amino acids from human KLF4. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Rat
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Induced pluripotent stem cells
Filter by
Target Symbol
Clonalities
Conjugates
Modifications
Pathways
- Pathways in cancer (19)
- MAPK signaling pathway (18)
- TGF-beta signaling pathway (16)
- Acute myeloid leukemia (10)
- Endometrial cancer (10)
- Bladder cancer (9)
- Colorectal cancer (9)
- ErbB signaling pathway (9)
- Wnt signaling pathway (9)
- Cell cycle (8)
- Chronic myeloid leukemia (8)
- Hedgehog signaling pathway (8)
- Jak-STAT signaling pathway (8)
- Small cell lung cancer (8)
- Thyroid cancer (8)
- Melanoma (7)
- Regulation of actin cytoskeleton (7)
- Basal cell carcinoma (5)
- Cytokine-cytokine receptor interaction (5)
- Maturity onset diabetes of the young (5)
- Huntington's disease (4)
- Neurotrophin signaling pathway (4)
- Cysteine and methionine metabolism (3)
- Endocytosis (3)
- Metabolic pathways (3)
- Focal adhesion (2)
- Gap junction (2)
- Hematopoietic cell lineage (2)
- Melanogenesis (2)
- Prostate cancer (2)
- Type II diabetes mellitus (2)
- Glioma (1)
- Non-small cell lung cancer (1)
- Pancreatic cancer (1)