Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RORB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RORB

Rabbit Polyclonal Anti-RORB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORB antibody: synthetic peptide directed towards the C terminal of human RORB. Synthetic peptide located within the following region: KNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYK

RORB / ROR Beta Rabbit Polyclonal (Hinge Domain) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Dog, Gorilla, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Gibbon, Hamster, Horse (Predicted: Xenopus)
Conjugation Unconjugated
Immunogen RORB / ROR Beta antibody was raised against synthetic 18 amino acid peptide from hinge domain of human ROR Beta. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Hamster, Panda, Bovine, Dog, Bat, Horse, Rabbit, Opossum, Chicken, Platypus, Lizard (100%); Elephant, Xenopus (94%); Zebrafish (83%).