Primary Antibodies

View as table Download

Rabbit polyclonal anti-COX IV antibody, Loading control

Applications ChIP, ICC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Bovine, Primate, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073]

Rabbit Polyclonal Anti-COX4I1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human COX4I1

Anti-COX8A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-ATP1A1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 28-40 amino acids of human ATPase, Na+/K+ transporting, alpha 1 polypeptide

Rabbit Polyclonal Anti-UCRC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Rabbit Polyclonal Anti-ATP1B2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ATP1B2

Rabbit Polyclonal Anti-CACNA1C Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CACNA1C

Rabbit Polyclonal Anti-CACNA1D Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CACNA1D

Rabbit polyclonal CACNG6 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6.

Rabbit Polyclonal Nhe-1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Nhe-1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of the human Nhe-1. The immunogen is located within the last 50 amino acids of Nhe-1.

Rabbit Polyclonal Nhe-1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Nhe-1 antibody was raised against a 17 amino acid synthetic peptide near the center of the human Nhe-1. The immunogen is located within amino acids 490 - 540 of Nhe-1.

Rabbit Polyclonal antibody to COX4 (cytochrome c oxidase subunit IV isoform 1)

Applications IF, IHC, WB
Reactivities Human (Predicted: Chimpanzee)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 169 of COX4 (Uniprot ID#P13073)

Rabbit polyclonal anti-ATP1A1(NaK ATPase) antibody, Loading control

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ATP1A1

Rabbit Polyclonal Anti-ATP1B1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP1B1 antibody: synthetic peptide directed towards the middle region of human ATP1B1. Synthetic peptide located within the following region: VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL

Rabbit polyclonal anti-COX6C antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human COX6C.