Primary Antibodies

Jump to Filters
View as table Download
NOX5 Rabbit Polyclonal Antibody
TA350234

USD 380.00

In Stock

Rabbit Polyclonal Anti-NOX5 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NOX5
NOX5 Rabbit Polyclonal Antibody
TA315785

USD 380.00

4 Weeks

Rabbit polyclonal anti-NOX5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human NOX5.
NOX5 Rabbit Polyclonal Antibody
TA338656

USD 539.00

5 Days

Rabbit Polyclonal Anti-NOX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NOX5 antibody is: synthetic peptide directed towards the C-terminal region of Human NOX5. Synthetic peptide located within the following region: DQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITG