Primary Antibodies

Jump to Filters
View as table Download
CLIC4 Rabbit Polyclonal Antibody
TA326231

USD 380.00

In Stock

Rabbit polyclonal CLIC4 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human CLIC4.
CLIC4 Rabbit Polyclonal Antibody
TA351085

USD 380.00

In Stock

Rabbit Polyclonal Anti-CLIC4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLIC4
CLIC4 Rabbit Polyclonal Antibody
TA338569

USD 485.00

5 Days

Rabbit Polyclonal Anti-CLIC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC4 antibody: synthetic peptide directed towards the N terminal of human CLIC4. Synthetic peptide located within the following region: LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF