Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-HNRPD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the C terminal of human HNRPD. Synthetic peptide located within the following region: YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP

Rabbit polyclonal hnRPD (Ab-83) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human hnRPD around the phosphorylation site of serine 83 (N-S-SP-P-R)

Rabbit polyclonal hnRPD (Ser83) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human hnRPD around the phosphorylation site of serine 83 (N-S-SP-P-R).
Modifications Phospho-specific