Primary Antibodies

Jump to Filters
View as table Download
KCNMB3 Rabbit Polyclonal Antibody
TA351321

USD 380.00

In Stock

Rabbit Polyclonal Anti-KCNMB3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNMB3
KCNMB3 Rabbit Polyclonal Antibody
TA371397

USD 380.00

4 Weeks

KCNMB3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNMB3
KCNMB3 Rabbit Polyclonal Antibody
TA338746

USD 539.00

5 Days

Rabbit Polyclonal Anti-KCNMB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNMB3 antibody: synthetic peptide directed towards the middle region of human KCNMB3. Synthetic peptide located within the following region: SLTLLGGALIVGMVRLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLC