Primary Antibodies

Jump to Filters
View as table Download
PDK1 Rabbit Polyclonal Antibody
TA329402

USD 539.00

5 Days

Rabbit Polyclonal anti-PDK1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PDK1 antibody: synthetic peptide directed towards the middle region of human PDK1. Synthetic peptide located within the following region: ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY
PDK1 Rabbit Polyclonal Antibody
TA326285

USD 380.00

4 Weeks

Rabbit polyclonal PDK1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PDK1.