Rabbit Polyclonal Anti-VPS4A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human VPS4A |
Rabbit Polyclonal Anti-VPS4A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human VPS4A |
Rabbit Polyclonal Anti-VPS4A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VPS4A antibody: synthetic peptide directed towards the N terminal of human VPS4A. Synthetic peptide located within the following region: YFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKE |
Rabbit Polyclonal Anti-VPS4A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VPS4A antibody: synthetic peptide directed towards the N terminal of human VPS4A. Synthetic peptide located within the following region: LRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPN |