RAB31 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
RAB31 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-RAB31 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAB31. |
Rabbit Polyclonal Anti-RAB31 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rab31 antibody is: synthetic peptide directed towards the middle region of Rat Rab31. Synthetic peptide located within the following region: GSAAAVIVYDITKQDSFHTLKKWVKELKEHGPENIVMAIAGNKCDLSDIR |