Primary Antibodies

View as table Download

Rabbit Polyclonal LDL R Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human LDL Receptor protein (within residues 500-550). [Swiss-Prot# P01130]

Rabbit Polyclonal Anti-LDLR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LDLR antibody is: synthetic peptide directed towards the C-terminal region of Human LDLR. Synthetic peptide located within the following region: VDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEA

LDL Receptor (LDLR) (500-550) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated