Clathrin light chain (CLTB) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein from human CLTB |
Clathrin light chain (CLTB) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein from human CLTB |
Rabbit Polyclonal Anti-CLTA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLTA antibody: synthetic peptide directed towards the C terminal of human CLTA. Synthetic peptide located within the following region: KELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDF |
Rabbit Polyclonal Anti-CLTB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLTB antibody: synthetic peptide directed towards the C terminal of human CLTB. Synthetic peptide located within the following region: ADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLR |