Primary Antibodies

Jump to Filters
View as table Download
GNAL Rabbit Polyclonal Antibody
TA313932

USD 380.00

4 Weeks

Rabbit polyclonal anti-GNAL antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GNAL.
GNAL Rabbit Polyclonal Antibody
TA335039

USD 539.00

5 Days

Rabbit Polyclonal Anti-GNAL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAL antibody: synthetic peptide directed towards the C terminal of human GNAL. Synthetic peptide located within the following region: AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR