Primary Antibodies

Jump to Filters
View as table Download
Glutaminase (GLS) Rabbit Polyclonal Antibody
TA334558

USD 539.00

5 Days

Rabbit Polyclonal Anti-GLS Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLS antibody: synthetic peptide directed towards the c terminal of human GLS. Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
Carbonic Anhydrase IX (CA9) (Center) Rabbit Polyclonal Antibody
AP17162PU-N

USD 580.00

2 Weeks

Carbonic Anhydrase IX (CA9) (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CA9