Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PCBP1 Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCBP1 antibody is: synthetic peptide directed towards the middle region of Human PCBP1. Synthetic peptide located within the following region: PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF

Rabbit Polyclonal Anti-PCBP1 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCBP1 antibody: synthetic peptide directed towards the middle region of human PCBP1. Synthetic peptide located within the following region: CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM