Primary Antibodies

View as table Download

Rabbit polyclonal anti-NT5C1A antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NT5C1A.

NT5C1A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 98~127 amino acids from the N-terminal region of human 5NT1A

Rabbit Polyclonal Anti-NT5C1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NT5C1A antibody: synthetic peptide directed towards the C terminal of human NT5C1A. Synthetic peptide located within the following region: AHGLDRFFEHEKAHENKPLAQGPLKGFLEALGRLQKKFYSKGLRLECPIR