Primary Antibodies

View as table Download

Rabbit polyclonal ARNT2 Antibody (Center)

Applications IF, WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen This ARNT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 249-278 amino acids from the Central region of human ARNT2.

Rabbit polyclonal anti-ARNT2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ARNT2.

Rabbit Polyclonal Anti-ARNT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ARNT2 antibody is: synthetic peptide directed towards the N-terminal region of Human ARNT2. Synthetic peptide located within the following region: VTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHS