Primary Antibodies

View as table Download

Rabbit Polyclonal anti-CUX1 Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CUX1

Rabbit Polyclonal anti-CUX1 Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CUX1

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit polyclonal anti-CUTL1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human CUTL1.

Rabbit Polyclonal Anti-CUTL1 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CUTL1 Antibody: A synthesized peptide

Rabbit Polyclonal Anti-CUX1 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CUX1 antibody: synthetic peptide directed towards the N terminal of human CUX1. Synthetic peptide located within the following region: VKNQEVTIKALKEKIREYEQTLKNQAETIALEKEQKLQNDFAEKERKLQE