Primary Antibodies

View as table Download

Ionotropic Glutamate receptor 2 (GRIA2) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal IGF1R Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IGF1R

Rabbit Polyclonal Anti-PLA2G2E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G2E antibody: synthetic peptide directed towards the middle region of human PLA2G2E. Synthetic peptide located within the following region: GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP

Rabbit Polyclonal Anti-GRM5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRM5 Antibody: A synthesized peptide derived from internal of human GRM5.

Ionotropic Glutamate receptor 2 (GRIA2) (+ GLUR3) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Chicken, Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Peptide corresponding to amino acid residues from the C-terminal region of rat GluR2/3.

Rabbit anti-IGF1R (Phospho-Tyr1165/Tyr1166) polyclonal antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanIGF-1R around the phosphorylation site of tyrosine 1165/tyrosine 1166(T-D-YP-YP-R-K).
Modifications Phospho-specific

Rabbit polyclonal Glutamate receptor 2 (Ser880) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-SP-V-K).
Modifications Phospho-specific

Rabbit Polyclonal Anti-Gria3 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gria3 antibody is: synthetic peptide directed towards the middle region of Rat Gria3. Synthetic peptide located within the following region: TVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYM

Rabbit Polyclonal Anti-Gria3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Gria3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EEMDRRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYMLANLGFTDIV

Rabbit Polyclonal anti-GRM5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRM5