Rabbit Polyclonal Antibody against Fe65
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant rat protein expressed in bacteria. |
Rabbit Polyclonal Antibody against Fe65
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant rat protein expressed in bacteria. |
Rabbit Polyclonal Anti-TNFRSF1A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI |
Rabbit Polyclonal anti-ATF6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATF6 antibody: synthetic peptide directed towards the N terminal of human ATF6. Synthetic peptide located within the following region: GYFTDTDELQLEAANETYENNFDNLDFDLDLMPWESDIWDINNQICTVKD |
Rabbit anti-APBB1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human APBB1 |
PPP3CB Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PPP3CB |
ATF6 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ATF6 |