Primary Antibodies

Jump to Filters
View as table Download
Caspase 9 (CASP9) Rabbit Polyclonal Antibody
TA312629

USD 380.00

In Stock

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 9.
Cyclin E1 (CCNE1) Rabbit Polyclonal Antibody
TA311853

USD 380.00

2 Weeks

Rabbit polyclonal anti-Cyclin E1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin E1.
p53 (TP53) Rabbit Polyclonal Antibody
TA329140

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
p53 (TP53) Rabbit Polyclonal Antibody
TA327567

USD 365.00

3 Weeks

Rabbit anti-TP53 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TP53
Cyclin B1 (CCNB1) Rabbit Polyclonal Antibody
AP09514PU-N

USD 405.00

2 Weeks

Cyclin B1 (CCNB1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.145~149 (A-F-S-D-V) derived from Human Cyclin B1
Cyclin B1 (CCNB1) Rabbit Polyclonal Antibody
AP09514PU-S

USD 315.00

2 Weeks

Cyclin B1 (CCNB1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.145~149 (A-F-S-D-V) derived from Human Cyclin B1
Caspase 9 (CASP9) Rabbit Polyclonal Antibody
TA336326

USD 450.00

5 Days

Rabbit Polyclonal Caspase-9 Antibody

Applications FC, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant catalytically active human Caspase-9 protein was used as immunogen (NP_001220).
Caspase 9 (CASP9) Rabbit Polyclonal Antibody
TA336327

USD 450.00

5 Days

Rabbit Polyclonal Caspase-9 Antibody

Applications ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant full-length human Caspase-9 protein (pro-form) was used as an immunogen (NP_001220).
Cyclin D1 (CCND1) Rabbit Polyclonal Antibody
AP20500PU-N

USD 465.00

3 Weeks

Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1.
Cyclin E1 (CCNE1) Rabbit Polyclonal Antibody
TA311854

USD 380.00

In Stock

Rabbit polyclonal Cyclin E1 (Ab-395) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-T-P-P).
Cyclin B1 (CCNB1) Rabbit Polyclonal Antibody
TA312651

USD 380.00

In Stock

Rabbit polyclonal Cyclin B1 (Ab-126) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin B1 around the phosphorylation site of serine 126 (T-A-S-P-S).
p53 (TP53) Rabbit Polyclonal Antibody
TA329141

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
p53 (TP53) Rabbit Polyclonal Antibody
TA329146

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
Caspase 9 (CASP9) Rabbit Polyclonal Antibody
TA312637

USD 380.00

4 Weeks

Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L).
Modifications Phospho-specific
Caspase 9 (CASP9) Rabbit Polyclonal Antibody
TA321308

USD 380.00

In Stock

Anti-CASP9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 139-389 amino acids of Human Caspase-9