Anti-MMP28 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human matrix metallopeptidase 28 |
Anti-MMP28 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human matrix metallopeptidase 28 |
Anti-MMP28 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human matrix metallopeptidase 28 |
Rabbit Polyclonal Anti-MMP28 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MMP28 antibody is: synthetic peptide directed towards the N-terminal region of Human MMP28. Synthetic peptide located within the following region: LDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFSDAIRAFQWV |
MMP28 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |