Rabbit polyclonal IL-8R beta/CDw128 beta (Ser347) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of serine 347 (R-P-SP-F-V). |
| Modifications | Phospho-specific |
Thrombin Receptor (F2R) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal CCR5 (Ser336) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CCR5 around the phosphorylation site of serine 336 (R-A-SP-S-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-ADRB3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADRB3. |
Rabbit Polyclonal Adrenergic Receptor beta2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Adrenergic Receptor beta2 |
Rabbit Polyclonal IL-8R beta/CDw128 beta (Ser347) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of Serine 347 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-F2R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2R antibody: synthetic peptide directed towards the N terminal of human F2R. |
Rabbit Polyclonal Anti-F2R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2R antibody: synthetic peptide directed towards the C terminal of human F2R. Synthetic peptide located within the following region: YAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSA |
Rabbit Polyclonal Anti-IL8RB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL8RB antibody: synthetic peptide directed towards the N terminal of human IL8RB. Synthetic peptide located within the following region: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF |
Rabbit Polyclonal Anti-Thrombin Receptor Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Thrombin Receptor Antibody: A synthesized peptide derived from human Thrombin Receptor |
Rabbit Polyclonal Anti-Phospho-CCR5(Ser349) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-CCR5(Ser349) Antibody: A synthesized peptide derived from human CCR5 around the phosphorylation site of Sersine 349 |
| Modifications | Phospho-specific |
ADRB3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ADRB3 |
Rabbit polyclonal CCR5 (Ser349) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CCR5 around the phosphorylation site of serine 349 (E-I-SP-V-G). |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China