Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GGT1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GGT1
TA350015 is a possible alternative to TA323391.

Rabbit Polyclonal antibody to GGT1 (gamma-glutamyltransferase 1)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 226 of GGT1 (Uniprot ID#P19440)

GBA3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 295-325 amino acids from the C-terminal region of Human Cytosolic beta-glucosidase

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the N terminal of human SHMT2. Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the C terminal of human SHMT2. Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE

GGT1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GGT1