Primary Antibodies

View as table Download

Anti-AIFM1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human apoptosis-inducing factor, mitochondrion-associated, 1

Anti-AIFM1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human apoptosis-inducing factor, mitochondrion-associated, 1

Rabbit anti-AIFM1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AIFM1

Rabbit Polyclonal AIF Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AIF antibody was raised against a peptide corresponding to amino acids 517 to 531 of human AIF. This sequence is identical to those of mouse and rat AIF.

Rabbit Polyclonal Anti-AIFM1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDCD8 antibody: synthetic peptide directed towards the N terminal of human PDCD8. Synthetic peptide located within the following region: GAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPS

Rabbit Polyclonal AIF Antibody

Applications IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Bovine, Canine
Conjugation Unconjugated
Immunogen (aa 151-170); human