Primary Antibodies

Jump to Filters
View as table Download
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA322830

USD 380.00

4 Weeks

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A
1 AGP acyltransferase 4 (AGPAT4) Rabbit Polyclonal Antibody
TA321869

USD 380.00

In Stock

Anti-AGPAT4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 146-306 amino acids of human 1-acylglycerol-3-phosphate O-acyltransferase 4
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA322829

USD 380.00

In Stock

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A
PLA2G2D (C-term) Rabbit Polyclonal Antibody
AP53324PU-N

USD 580.00

2 Weeks

PLA2G2D (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 112-138 amino acids from the C-terminal region of human PLA2G2D
AGPAT2 Rabbit Polyclonal Antibody
TA356399

USD 539.00

5 Days

AGPAT2 Antibody - C-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA329515

USD 485.00

5 Days

Rabbit Polyclonal anti-PPAP2A antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA346363

USD 485.00

5 Days

Rabbit Polyclonal Anti-PPAP2A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL