Primary Antibodies

View as table Download

Smoothened (SMO) (N-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SMO antibody was raised against synthetic peptide - KLH conjugated

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

APC2 rabbit polyclonal antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen APC2 antibody was raised against synthetic peptide - KLH conjugated

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP

Rabbit Polyclonal Gli1 Antibody

Applications ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made toward the C-terminus portion of the human Gli1 protein (between residues 800-850) [UniProt P08151]

BMP2 (+ BMP4) rabbit polyclonal antibody, Purified

Applications ELISA, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly purified Synthetic peptide C-terminal (20 amino acids) of Human BMP-2/4.

Rabbit Polyclonal WNT2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal WNT4 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal WNT8A Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal Dishevelled 3 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal APC Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.