Nqo1 (NM_008706) Mouse Recombinant Protein

CAT#: TP527333

Purified recombinant protein of Mouse NAD(P)H dehydrogenase, quinone 1 (Nqo1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR227333 representing NM_008706
  Red=Cloning site Green=Tags(s)
  
  MAARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSKNFQYPS
  ESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQN
  KKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKK
  RLETVWEETPLYFAPSSLFDLNFQAGFLMKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 31.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032732
• Locus ID: 18104
• UniProt ID: Q64669, Q542Y0
• Cytogenetics: 8 54.08 cM
• Refseq Size: 1552
• Refseq ORF: 822
• Synonyms: AV001255; Dia4; Dtd; Nmo-1; Nmo1; Nmor1; Ox-1; Ox1; Qr1
• Summary: The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.[UniProtKB/Swiss-Prot Function]