Rasgrp2 (NM_011242) Mouse Recombinant Protein

CAT#: TP526786

Purified recombinant protein of Mouse RAS, guanyl releasing protein 2 (Rasgrp2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR226786 representing NM_011242
  Red=Cloning site Green=Tags(s)
  
  MTSTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLHFYQQSRKDNSNS
  LQMKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIESVPTYKWKRQVTQRNPVE
  QKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLM
  ILSKPTATQRALVITHFVHVAERLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPDTIKLWEGLTELV
  TATGNYSNYRRRLAACVGFRFPILGVHLKDLVALQLALPDWLDPGRTRLNGAKMRQLFCILEELAMVTSL
  RPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSVAKPKLDQ
  ALVAEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMISYFLRSSSV
  LGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKERLSVECRRRAQSVSLEGS
  APSPSPTHTHHRAFSFSLPRPGRRSSRPPEIREEEVQSVEDGVFDIHL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 69.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_035372
• Locus ID: 19395
• UniProt ID: Q9QUG9
• Cytogenetics: 19 A
• Refseq Size: 2209
• Refseq ORF: 1824
• Synonyms: Caldaggef1; CDC25L
• Summary: Functions as a calcium- and DAG-regulated nucleotide exchange factor specifically activating Rap through the exchange of bound GDP for GTP. May also activates other GTPases such as RRAS, RRAS2, NRAS, KRAS but not HRAS. Functions in aggregation of platelets and adhesion of T-lymphocytes and neutrophils probably through inside-out integrin activation. May function in the muscarinic acetylcholine receptor M1/CHRM1 signaling pathway.[UniProtKB/Swiss-Prot Function]