Dclk2 (NM_001195496) Mouse Recombinant Protein

CAT#: TP526382

Purified recombinant protein of Mouse doublecortin-like kinase 2 (Dclk2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 988.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "Dclk2"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR226382 representing NM_001195496
Red=Cloning site Green=Tags(s)

MASTRSIELEHFEERDKRPRPGSRRGAPSSSGGSSISGPKGNGLIPSPAHSAHCSFYRTRTLQALSSEKK
AKKARFYRNGDRYFKGLVFAISNDRFRSFDALLIELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLE
GESYVCASNEPFRKVDYTKNVNPNWSVNIKGGTTRTLAVASAKSEVKESKDFIKPKLVTVIRSGVKPRKA
VRILLNKKTAHSFEQVLTDITEAIKLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKYRYAQDDF
VLDHSECRVLKSSYSRASAAKYSGSRSPGFSRRSKSPASVKRAGHSSAYSTAKSPVNGTPSSQLSTPKST
KSSSSSPTSPGSFRGLKISAQGRSSSNVNGGPELDRCLSPEGVNGNRCSESFPLLEKYRIGKVIGDGNFA
VVKECVDRYTGKEFALKIIDKAKCCGKEHLIENEVSILRRVKHPNIIMLVEEMETATDLFLVMELVKGGD
LFDAITSSTKYTERDGSAMVYNLANALRYLHSLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEG
PLYTVCGTPTYVAPEIIAETGYGLKVDVWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPY
WDNITDSAKELISQMLQVNVEARCTAGEILSHPWVSDDASQENNMQAEVTGKLKQHFNNALPKQNSTTTG
VSVIMNTALDKEGQIFCSKLCQDSSRPSREQTSPVPPSAQEAPPPLESPRPPGPPATSGCDLAGTWRRHR
D

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 84.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001182425
Locus ID 70762
UniProt ID Q6PGN3
Cytogenetics 3 F1
Refseq Size 4092
Refseq ORF 2313
Synonyms 6330415M09Rik; AU044875; CL2; Clic; Click-II; CLICK2; Dcamk; Dcamkl2
Summary This gene encodes a member of the protein kinase superfamily and the doublecortin family. The protein encoded by this gene contains two N-terminal doublecortin domains, which bind microtubules and regulate microtubule polymerization, a C-terminal serine/threonine protein kinase domain, which shows substantial homology to Ca2+/calmoduline-dependent protein kinase, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains, which mediates multiple protein-protein interactions. The microtubule-polymerizing activity of the encoded protein is independent of its protein kinase activity. This gene and the DCX gene, another family member, share function in the establishment of hippocampal organization and their absence results in a severe epileptic phenotype and lethality, as described in human patients with lissencephaly. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Sep 2010]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.