Tyrp1 (NM_031202) Mouse Recombinant Protein

CAT#: TP526278

Purified recombinant protein of Mouse tyrosinase-related protein 1 (Tyrp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Tyrp1 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR226278 representing NM_031202
  Red=Cloning site Green=Tags(s)
  
  MKSYNVLPLAYISLFLMLFYQVWAQFPRECANIEALRRGVCCPDLLPSSGPGTDPCGSSSGRGRCVAVIA
  DSRPHSRHYPHDGKDDREAWPLRFFNRTCQCNDNFSGHNCGTCRPGWRGAACNQKILTVRRNLLDLSPEE
  KSHFVRALDMAKRTTHPQFVIATRRLEDILGPDGNTPQFENISVYNYFVWTHYYSVKKTFLGTGQESFGD
  VDFSHEGPAFLTWHRYHLLQLERDMQEMLQEPSFSLPYWNFATGKNVCDVCTDDLMGSRSNFDSTLISPN
  SVFSQWRVVCESLEEYDTLGTLCNSTEGGPIRRNPAGNVGRPAVQRLPEPQDVTQCLEVRVFDTPPFYSN
  STDSFRNTVEGYSAPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNA
  DISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYAYEVQWPGQEFTVSEIITIAVVAALLLV
  AAIFGVASCLIRSRSTKNEANQPLLTDHYQRYAEDYEELPNPNHSMV
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 61.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_112479
• Locus ID: 22178
• UniProt ID: P07147, Q3UFS3
• Cytogenetics: 4 37.89 cM
• Refseq Size: 2755
• Refseq ORF: 1611
• Synonyms: b; brown; isa; Oca3; TRP-1; TRP1; Tyrp
• Summary: Plays a role in melanin biosynthesis (PubMed:2245916). Catalyzes the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid (PubMed:7813420). May regulate or influence the type of melanin synthesized (PubMed:7813420, PubMed:2245916). Also to a lower extent, capable of hydroxylating tyrosine and producing melanin (PubMed:1537333).[UniProtKB/Swiss-Prot Function]