Bcl3 (NM_033601) Mouse Recombinant Protein

CAT#: TP525844

Purified recombinant protein of Mouse B cell leukemia/lymphoma 3 (Bcl3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR225844 representing NM_033601
  Red=Cloning site Green=Tags(s)
  
  MPRCPAGAMDEGPVDLRTRPKGTPGAALPLRKRPLRPASPEPATTRSPAGPLDALRSGCDVPVVPGPPHC
  VARPEALYYQGPLMPIYSTPTMAPHFPLLNLPTHPYSMICPMEHPLSADIAMATRVDEDGDTPLHIAVVQ
  NNIAAVYRILSLFKLGSREVDVHNNLRQTPLHLAVITTLPDMVRLLVTAGASPMALDRHGQTAIHLACEH
  RSPSCLQALLDSATSGSVDLEVRNYEGLTALHVAVNTGCQEAVLLLLERGADIDAVDIKSGRSPLIHAVE
  NNSLNMVQLLLLHGANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSGLKNCHNDTPLMVARSRRVI
  DILRGKASRAASGSQPEPSPDQSATNSPESSSRLSSNGLQSSPSSSPSLSPPKDAPGFPATPQNFFLPTT
  STPAFLPFPGVLRGPGRPVPPSPAPGSS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 47.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_291079
• Locus ID: 12051
• UniProt ID: Q9Z2F6
• Cytogenetics: 7 9.95 cM
• Refseq Size: 1835
• Refseq ORF: 1344
• Synonyms: AI528691; Bcl-3
• Summary: Contributes to the regulation of transcriptional activation of NF-kappa-B target genes. In the cytoplasm, inhibits the nuclear translocation of the NF-kappa-B p50 subunit (By similarity). In the nucleus, acts as transcriptional activator that promotes transcription of NF-kappa-B target genes. Contributes to the regulation of cell proliferation.[UniProtKB/Swiss-Prot Function]