Arsb (NM_009712) Mouse Recombinant Protein

CAT#: TP524881

Purified recombinant protein of Mouse arylsulfatase B (Arsb), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 988.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Arsb Antibody - middle region
    • 100 ul

USD 539.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "Arsb"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR224881 representing NM_009712
Red=Cloning site Green=Tags(s)

MGKLSPCTGRSRPGGPGPQLPLLLLLLQLLLLLLSPARASGATQPPHVVFVLADDLGWNDLGFHGSVIRT
PHLDALAAGGVVLDNYYVQPLCTPSRSQLLTGRYQIHLGLQHYLIMTCQPSCVPLDEKLLPQLLKEAGYA
THMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYTHEACAPIESLNGTRCALDLRDGEEPAKEYNNI
YSTNIFTKRATTVIANHPPEKPLFLYLAFQSVHDPLQVPEEYMEPYGFIQDKHRRIYAGMVSLMDEAVGN
VTKALKSHGLWNNTVFIFSTDNGGQTRSGGNNWPLRGRKGTLWEGGIRGTGFVASPLLKQKGVKSRELMH
ITDWLPTLVDLAGGSTNGTKPLDGFNMWKTISEGHPSPRVELLHNIDQDFFDGLPCPGKNMTPAKDDSFP
LEHSAFNTSIHAGIRYKNWKLLTGHPGCGYWFPPPSQSNVSEIPPVDPPTKTLWLFDINQDPEERHDVSR
EHPHIVQNLLSRLQYYHEHSVPSHFPPLDPRCDPKSTGVWSPWM

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 59.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_033842
Locus ID 11881
UniProt ID P50429, A0A0R4J138
Cytogenetics 13 47.88 cM
Refseq Size 3989
Refseq ORF 1602
Synonyms 1110007C02Rik; AI480648; As-1; As-1r; As-1s; As-1t; As1; As1-r; As1-s; As1-t; Asr-1; Ast-1
Summary Removes sulfate groups from chondroitin-4-sulfate (C4S) and regulates its degradation (By similarity). Involved in the regulation of cell adhesion, cell migration and invasion in colonic epithelium (By similarity). In the central nervous system, is a regulator of neurite outgrowth and neuronal plasticity, acting through the control of sulfate glycosaminoglycans and neurocan levels (By similarity).[UniProtKB/Swiss-Prot Function]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.