Nlrp10 (NM_175532) Mouse Recombinant Protein

CAT#: TP523786

Purified recombinant protein of Mouse NLR family, pyrin domain containing 10 (Nlrp10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR223786 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALARANSPQEALLWALNDLEENSFKTLKFHLRDVTQFHLARGELESLSQVDLASKLISMYGAQEAVRVV
  SRSLLAMNLMELVDYLNQVCLNDYREIYREHVRCLEERQDWGVNSSHNKLLLMATSSSGGRRSPSCSDLE
  QELDPVDVETLFAPEAESYSTPPIVVMQGSAGTGKTTLVKKLVQDWSKGKLYPGQFDYVFYVSCREVVLL
  PKCDLPNLICWCCGDDQAPVTEILRQPGRLLFILDGYDELQKSSRAECVLHILMRRREVPCSLLITTRPP
  ALQSLEPMLGERRHVLVLGFSEEERETYFSSCFTDKEQLKNALEFVQNNAVLYKACQVPGICWVVCSWLK
  KKMARGQEVSETPSNSTDIFTAYVSTFLPTDGNGDSSELTRHKVLKSLCSLAAEGMRHQRLLFEEEVLRK
  HGLDGPSLTAFLNCIDYRAGLGIKKFYSFRHISFQEFFYAMSFLVKEDQSQQGEATHKEVAKLVDPENHE
  EVTLSLQFLFDMLKTEGTLSLGLKFCFRIAPSVRQDLKHFKEQIEAIKYKRSWDLEFSLYDSKIKKLTQG
  IQMKDVILNVQHLDEKKSDKKKSVSVTSSFSSGKVQSPFLGNDKSTRKQKKASNGKSRGAEEPAPGVRNR
  RLASREKGHMEMNDKEDGGVEEQEDEEGQTLKKDGEMIDKMNG
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 76.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_780741
• Locus ID: 244202
• UniProt ID: Q8CCN1, Q6JGS9, Q3V3Z6
• Cytogenetics: 7 E3
• Refseq Size: 4483
• Refseq ORF: 2022
• Synonyms: 6430548I20Rik; Nalp10; Napl10; PAN5; Pynod
• Summary: Inhibits autoprocessing of CASP1, CASP1-dependent IL1B secretion, PYCARD aggregation and PYCARD-mediated apoptosis but not apoptosis induced by FAS or BID (By similarity). Displays anti-inflammatory activity (By similarity). Required for immunity against C.albicans infection (PubMed:23071280). Involved in the innate immune response by contributing to proinflammatory cytokine release in response to invasive bacterial infection (By similarity). Contributes to T-cell-mediated inflammatory responses in the skin (PubMed:27221772). Plays a role in protection against periodontitis through its involvement in induction of IL1A via ERK activation in oral epithelial cells infected with periodontal pathogens (By similarity). Exhibits both ATPase and GTPase activities (By similarity).[UniProtKB/Swiss-Prot Function]