Gapt (NM_177713) Mouse Recombinant Protein
CAT#: TP520644
Purified recombinant protein of Mouse Grb2-binding adaptor, transmembrane (Gapt), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
![](https://cdn.origene.com/img/defaults-img.jpg)
Frequently bought together (2)
Other products for "Gapt"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR220644 protein sequence
Red=Cloning site Green=Tags(s) MLECFESSPVAVAVGVSLLVLLLLCGIGCAWHWNRRESTPFTLPKFMQRRSSRQKDVTKTVSSSAYVISP SMKASVESKGHKSTAKRNKMHGNYENVEVCPPCTEGTTEKALYENTQPSNLEEHVYGNQTDPLYYNFQKP SPPPPQDDDIYILPDCD myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 17.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_808381 |
Locus ID | 238875 |
UniProt ID | Q8CB93 |
Cytogenetics | 13 D2.1 |
Refseq Size | 2055 |
Refseq ORF | 474 |
Synonyms | 9830130M13Rik |
Summary | Negatively regulates B-cell proliferation following stimulation through the B-cell receptor. May play an important role in maintenance of marginal zone (MZ) B-cells.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.