Shbg (NM_011367) Mouse Recombinant Protein

CAT#: TP518620

Purified recombinant protein of Mouse sex hormone binding globulin (Shbg), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 988.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (2)
SHBG Antibody - middle region
    • 100 ul

USD 539.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "Shbg"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR218620 representing NM_011367
Red=Cloning site Green=Tags(s)

MEKRDSVALHWRLLLLLLLLMPPPTHQGRALRHIDPIQSAQDPPAKYLSNGPGQEPVMVMTIDLTKISKP
HSSFEFRTWDPEGVIFYGDTNTEDDWFLLGLRAGQLEIQLHNAWARLTVGFGPRLDDGRWHPVELKMNGD
SLLLWVDGKEMLCLRQISASLADHSQRSMRIALGGLLLPTSKLRFPLVPALDGCIRRDIWLGHQAQLSAS
PRTSLGNCDVDLQPGLFFPPGTHAEFSLQDIPQPHADPWTFSLELGFKLVDGSGQLLALGTGTNSSWLNI
HLQNQSVVLSSEAEPKVVLPLDVGLPLQLTLDRVKVVLSQGPKMEVLSMSLLRPASLWRLWSHPQGHLSL
GALPGESSSASFCLSDFWVQGQRLDIDQALSRSQDIWTHSCPQRPSNDTRTSH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 45.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_035497
Locus ID 20415
UniProt ID P97497, A0A158SIS9
Cytogenetics 11 42.86 cM
Refseq Size 1407
Refseq ORF 1209
Synonyms ABP
Summary Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma metabolic clearance rate of steroid hormones by controlling their plasma concentration (By similarity).[UniProtKB/Swiss-Prot Function]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.