Ppm1k (NM_175523) Mouse Recombinant Protein

CAT#: TP517753

Purified recombinant protein of Mouse protein phosphatase 1K (PP2C domain containing) (Ppm1k), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR217753 representing NM_175523
  Red=Cloning site Green=Tags(s)
  
  MLSAAFITLLRSGGNQVKKRVLLSSILLQDHRQATPACYFSTSEARCSRFDPDGSGQPATWDNFGIWDNR
  IDEPILLPPSIKYGKPIPKISLENVGCASLIGKRKENEDRFGFAQLTEEVLYFAVYDGHGGPAAADFCHT
  HMEKCVMDLLPREKDLETVLTLAFLEIDKAFASYAHLSADASLLTSGTTATVALLRDGVELVVASVGDSR
  ALLCRKGKPMKLTTDHTPERKDEKERIKKFGGFVAWNSLGQPHVNGRLAMTRSIGDLDLKASGVIAEPET
  TRIKLYHADDSFLVLTTDGINFMVNSQEICDFVNQCHDPKEAAHSVTEQAIQYGTEDNSTAVVVPFGAWG
  KYKNSEITFSFSRSFASSGRWA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 40.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_780732
• Locus ID: 243382
• UniProt ID: Q8BXN7, B9EHW0
• Cytogenetics: 6 B3
• Refseq Size: 5560
• Refseq ORF: 1116
• Synonyms: 2900063A19Rik; A930026L03Rik; PP2Cm
• Summary: Regulates the mitochondrial permeability transition pore and is essential for cellular survival and development.[UniProtKB/Swiss-Prot Function]